SQOR (NM_021199) Human Recombinant Protein
CAT#: TP302335
Recombinant protein of human sulfide quinone reductase-like (yeast) (SQRDL), nuclear gene encoding mitochondrial protein, 20 µg
View other "SQOR" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202335 protein sequence
Red=Cloning site Green=Tags(s) MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAEN VAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRY LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMY LSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDK PGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVA AQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKAD LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 49.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_067022 |
| Locus ID | 58472 |
| UniProt ID | Q9Y6N5 |
| Refseq Size | 2003 |
| Cytogenetics | 15q21.1 |
| Refseq ORF | 1350 |
| Synonyms | CGI-44; PRO1975; SQR; SQRDL |
| Summary | The protein encoded by this gene may function in mitochondria to catalyze the conversion of sulfide to persulfides, thereby decreasing toxic concencrations of sulfide. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412038 | SQRDL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412038 | Transient overexpression lysate of sulfide quinone reductase-like (yeast) (SQRDL), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH302335 | SQRDL MS Standard C13 and N15-labeled recombinant protein (NP_067022) |
CNY 19520.00 |
