PBLD (NM_022129) Human Recombinant Protein
CAT#: TP302328
Recombinant protein of human phenazine biosynthesis-like protein domain containing (PBLD), transcript variant 1, 20 µg
View other "PBLD" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202328 protein sequence
Red=Cloning site Green=Tags(s) MKLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDNFAQSSCFGLRWF TPASEVPLCGHATLASAAVLFHKIKNMNSTLTFVTLSGELRARRAEDGIVLDLPLYPAHPQDFHEVEDLI KTAIGNTLVQDICYSPDTQKLLVRLSDVYNRSFLENLKVNTENLLQVENTGKVKGLILTLKGEPGGQTQA FDFYSRYFAPWVGVAEDPVTGSAHAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDGRVDIRGGAAV VLEGTLTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071412 |
Locus ID | 64081 |
UniProt ID | P30039 |
Refseq Size | 2587 |
Cytogenetics | 10q21.3 |
Refseq ORF | 864 |
Synonyms | HEL-S-306; MAWBP; MAWDBP |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411757 | PBLD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411757 | Transient overexpression lysate of phenazine biosynthesis-like protein domain containing (PBLD), transcript variant 1 |
CNY 3080.00 |
|
PH302328 | PBLD MS Standard C13 and N15-labeled recombinant protein (NP_071412) |
CNY 19520.00 |
|
TP720507 | Recombinant protein of human phenazine biosynthesis-like protein domain containing (PBLD), transcript variant 1 |
CNY 1800.00 |