PSMD6 (NM_014814) Human Recombinant Protein
CAT#: TP302292
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6), 20 µg
View other "PSMD6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202292 representing NM_014814
Red=Cloning site Green=Tags(s) MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLL NKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDI VFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTS YELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQ EMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055629 |
Locus ID | 9861 |
UniProt ID | Q15008 |
Refseq Size | 1308 |
Cytogenetics | 3p14.1 |
Refseq ORF | 1167 |
Synonyms | p42A; p44S10; Rpn7; S10; SGA-113M |
Summary | This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012] |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415023 | PSMD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415023 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6) |
CNY 3080.00 |
|
PH302292 | PSMD6 MS Standard C13 and N15-labeled recombinant protein (NP_055629) |
CNY 19520.00 |