MYD88 (NM_002468) Human Recombinant Protein
CAT＃: TP302253
Recombinant protein of human myeloid differentiation primary response gene (88) (MYD88), 20 µg
View other "MYD88" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202253 protein sequence
Red=Cloning site Green=Tags(s) MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADP TGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPR TAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASE LIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPC TKSWFWTRLAKALSLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002459 |
| Locus ID | 4615 |
| UniProt ID | Q99836 |
| Refseq Size | 2862 |
| Cytogenetics | 3p22.2 |
| Refseq ORF | 888 |
| Synonyms | IMD68; MYD88D |
| Summary | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Apoptosis, Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400877 | MYD88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432175 | MYD88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432873 | MYD88 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400877 | Transient overexpression lysate of myeloid differentiation primary response gene (88) (MYD88) |
CNY 3080.00 |
|
| LY432175 | Transient overexpression lysate of myeloid differentiation primary response gene (88) (MYD88), transcript variant 2 |
CNY 3080.00 |
|
| LY432873 | Transient overexpression lysate of myeloid differentiation primary response gene (88) (MYD88), transcript variant 1 |
CNY 3080.00 |
|
| PH302253 | MYD88 MS Standard C13 and N15-labeled recombinant protein (NP_002459) |
CNY 19520.00 |
MYD88 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
