ZMAT5 (NM_019103) Human Recombinant Protein
CAT#: TP302215
Recombinant protein of human zinc finger, matrin type 5 (ZMAT5), transcript variant 1, 20 µg
View other "ZMAT5" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202215 protein sequence
Red=Cloning site Green=Tags(s) MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGS NCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYP VGWPPVQELPPSLRAPPPGGWPLQPRVQWG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061976 |
Locus ID | 55954 |
UniProt ID | Q9UDW3 |
Refseq Size | 1051 |
Cytogenetics | 22q12.2 |
Refseq ORF | 510 |
Synonyms | SNRNP20; U11/U12-20K; ZC3H19 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412745 | ZMAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423980 | ZMAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412745 | Transient overexpression lysate of zinc finger, matrin type 5 (ZMAT5), transcript variant 1 |
CNY 3080.00 |
|
LY423980 | Transient overexpression lysate of zinc finger, matrin type 5 (ZMAT5), transcript variant 2 |
CNY 3080.00 |
|
PH302215 | ZMAT5 MS Standard C13 and N15-labeled recombinant protein (NP_061976) |
CNY 19520.00 |