Hsc70 (HSPA8) (NM_006597) Human Recombinant Protein
CAT#: TP302209
Recombinant protein of human heat shock 70kDa protein 8 (HSPA8), transcript variant 1, 20 µg
View other "Hsc70" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 3 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202209 protein sequence
Red=Cloning site Green=Tags(s) MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDA KRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVT NAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSIL TIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQA SIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLL QDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQG KINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGA PPSGGASSGPTIEEVD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 70.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006588 |
Locus ID | 3312 |
UniProt ID | P11142 |
Refseq Size | 2473 |
Cytogenetics | 11q24.1 |
Refseq ORF | 1938 |
Synonyms | HEL-33; HEL-S-72p; HSC54; HSC70; HSC71; HSP71; HSP73; HSPA10; LAP-1; LAP1; NIP71 |
Summary | This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Identification of Synaptic DGKθ Interactors That Stimulate DGKθ Activity
,null,
Frontiers in Synaptic Neuroscience
,PubMed ID 35573662
[HSPA8]
|
A micropeptide encoded by lncRNA MIR155HG suppresses autoimmune inflammation via modulating antigen presentation
,Niu, L;Lou, F;Sun, Y;Sun, L;Cai, X;Liu, Z;Zhou, H;Wang, H;Wang, Z;Bai, J;Yin, Q;Zhang, J;Chen, L;Peng, D;Xu, Z;Gao, Y;Tang, S;Fan, L;Wang, H;,
Sci. Adv.
[HSPA8]
|
Induction of heat shock protein HSPA6 (HSP70B') upon HSP90 inhibition in cancer cell lines.
,null,
FEBS letters
,PubMed ID 25957766
[HSPA8]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401978 | HSPA8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407134 | HSPA8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401978 | Transient overexpression lysate of heat shock 70kDa protein 8 (HSPA8), transcript variant 1 |
CNY 3080.00 |
|
LY407134 | Transient overexpression lysate of heat shock 70kDa protein 8 (HSPA8), transcript variant 2 |
CNY 4840.00 |
|
PH302209 | HSPA8 MS Standard C13 and N15-labeled recombinant protein (NP_006588) |
CNY 19520.00 |