CNIH3 (NM_152495) Human Recombinant Protein
CAT#: TP302120
Recombinant protein of human cornichon homolog 3 (Drosophila) (CNIH3), 20 µg
View other "CNIH3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202120 protein sequence
Red=Cloning site Green=Tags(s) MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLP EYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLA FYLLSFFYYLYCMIYTLVSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689708 |
Locus ID | 149111 |
UniProt ID | Q8TBE1 |
Refseq Size | 2372 |
Cytogenetics | 1q42.12 |
Refseq ORF | 480 |
Synonyms | CNIH-3 |
Summary | Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407502 | CNIH3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407502 | Transient overexpression lysate of cornichon homolog 3 (Drosophila) (CNIH3) |
CNY 3080.00 |
|
PH302120 | CNIH3 MS Standard C13 and N15-labeled recombinant protein (NP_689708) |
CNY 19520.00 |