ETHE1 (NM_014297) Human Recombinant Protein
CAT#: TP302114
Recombinant protein of human ethylmalonic encephalopathy 1 (ETHE1), 20 µg
View other "ETHE1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202114 protein sequence
Red=Cloning site Green=Tags(s) MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGL RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCV TFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERT LNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQTPTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055112 |
Locus ID | 23474 |
UniProt ID | O95571 |
Refseq Size | 978 |
Cytogenetics | 19q13.31 |
Refseq ORF | 762 |
Synonyms | HSCO; YF13H12 |
Summary | This gene encodes a member of the metallo beta-lactamase family of iron-containing proteins involved in the mitochondrial sulfide oxidation pathway. The encoded protein catalyzes the oxidation of a persulfide substrate to sulfite. Certain mutations in this gene cause ethylmalonic encephalopathy, an infantile metabolic disorder affecting the brain, gastrointestinal tract and peripheral vessels. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402306 | ETHE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402306 | Transient overexpression lysate of ethylmalonic encephalopathy 1 (ETHE1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
PH302114 | ETHE1 MS Standard C13 and N15-labeled recombinant protein (NP_055112) |
CNY 19520.00 |