Noxa (PMAIP1) (NM_021127) Human Recombinant Protein
CAT#: TP302071
Recombinant protein of human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), 20 µg
View other "Noxa" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202071 representing NM_021127
Red=Cloning site Green=Tags(s) MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 5.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066950 |
| Locus ID | 5366 |
| UniProt ID | Q13794 |
| Refseq Size | 1885 |
| Cytogenetics | 18q21.32 |
| Refseq ORF | 162 |
| Synonyms | APR; NOXA |
| Summary | This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. [provided by RefSeq, Aug 2020] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | p53 signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402842 | PMAIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402842 | Transient overexpression lysate of phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) |
CNY 3080.00 |
|
| PH302071 | PMAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_066950) |
CNY 19520.00 |
