ID1 (NM_002165) Human Recombinant Protein
CAT#: TP302061
Recombinant protein of human inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202061 protein sequence
Red=Cloning site Green=Tags(s) MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMN GCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALT AEAACVPADDRILCR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002156 |
| Locus ID | 3397 |
| UniProt ID | P41134 |
| Refseq Size | 1000 |
| Cytogenetics | 20q11.21 |
| Refseq ORF | 465 |
| Synonyms | bHLHb24; ID |
| Summary | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400785 | ID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405746 | ID1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400785 | Transient overexpression lysate of inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 1 |
CNY 3080.00 |
|
| LY405746 | Transient overexpression lysate of inhibitor of DNA binding 1, dominant negative helix-loop-helix protein (ID1), transcript variant 2 |
CNY 3080.00 |
|
| PH302061 | ID1 MS Standard C13 and N15-labeled recombinant protein (NP_002156) |
CNY 19520.00 |

