AGR2 (NM_006408) Human Recombinant Protein
CAT#: TP302023
Recombinant protein of human anterior gradient homolog 2 (Xenopus laevis) (AGR2), 20 µg
View other "AGR2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202023 representing NM_006408
Red=Cloning site Green=Tags(s) MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006399 |
| Locus ID | 10551 |
| UniProt ID | O95994 |
| Refseq Size | 1701 |
| Cytogenetics | 7p21.1 |
| Refseq ORF | 525 |
| Synonyms | AG-2; AG2; GOB-4; HAG-2; HEL-S-116; HPC8; PDIA17; XAG-2 |
| Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416668 | AGR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416668 | Transient overexpression lysate of anterior gradient homolog 2 (Xenopus laevis) (AGR2) |
CNY 3080.00 |
|
| PH302023 | AGR2 MS Standard C13 and N15-labeled recombinant protein (NP_006399) |
CNY 19520.00 |
|
| TP720358 | Recombinant protein of human anterior gradient homolog 2 (Xenopus laevis) (AGR2) |
CNY 3140.00 |
