Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Recombinant Protein
CAT#: TP301973
Recombinant protein of human fatty acid binding protein 5 (psoriasis-associated) (FABP5), 20 µg
View other "Fatty Acid Binding Protein 5" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201973 protein sequence
Red=Cloning site Green=Tags(s) MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001435 |
Locus ID | 2171 |
UniProt ID | Q01469 |
Refseq Size | 751 |
Cytogenetics | 8q21.13 |
Refseq ORF | 405 |
Synonyms | E-FABP; EFABP; KFABP; PA-FABP; PAFABP |
Summary | This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400560 | FABP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400560 | Transient overexpression lysate of fatty acid binding protein 5 (psoriasis-associated) (FABP5) |
CNY 3080.00 |
|
PH301973 | FABP5 MS Standard C13 and N15-labeled recombinant protein (NP_001435) |
CNY 19520.00 |
|
TP720118 | Recombinant protein of human fatty acid binding protein 5 (psoriasis-associated) (FABP5) |
CNY 1800.00 |
其它Fatty Acid Binding Protein 5产品