NBL1 (NM_005380) Human Recombinant Protein
CAT#: TP301954L
Recombinant protein of human neuroblastoma, suppression of tumorigenicity 1 (NBL1), transcript variant 2, 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
货期*
4周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201954 protein sequence
Red=Cloning site Green=Tags(s) MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNT FPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDG PGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 17.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005371 |
| Locus ID | 4681 |
| UniProt ID | P41271 |
| Refseq Size | 2184 |
| Cytogenetics | 1p36.13 |
| Refseq ORF | 540 |
| Synonyms | D1S1733E; DAN; DAND1; NB; NO3 |
| Summary | This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants have been identified for this gene. Read-through transcripts between this locus and the upstream mitochondrial inner membrane organizing system 1 gene (GeneID 440574) have been observed. [provided by RefSeq, May 2013] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
