PINX1 (NM_017884) Human Recombinant Protein
CAT#: TP301903
Recombinant protein of human PIN2-interacting protein 1 (PINX1), 20 µg
View other "PINX1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201903 protein sequence
Red=Cloning site Green=Tags(s) MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGAT INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSK TDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERK RGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDH VQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060354 |
Locus ID | 54984 |
UniProt ID | Q96BK5 |
Refseq Size | 1570 |
Cytogenetics | 8p23.1 |
Refseq ORF | 984 |
Synonyms | Gno1; LPTL; LPTS; Pxr1 |
Summary | Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413467 | PINX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413467 | Transient overexpression lysate of PIN2-interacting protein 1 (PINX1) |
CNY 3080.00 |
|
PH301903 | PINX1 MS Standard C13 and N15-labeled recombinant protein (NP_060354) |
CNY 19520.00 |