ASCC1 (NM_015947) Human Recombinant Protein
CAT#: TP301872
Recombinant protein of human activating signal cointegrator 1 complex subunit 1 (ASCC1), 20 µg
View other "ASCC1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201872 protein sequence
Red=Cloning site Green=Tags(s) MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTLRAPSLLY KHIVGKRGDTRKKIEMETKTSISIPKPGQDGEIVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLAFF LNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHLTIGMLVLLSEEEIQQTCEMLQQCKEEFIND ISGGKPLEVEMAGIEYMNDDPGMVDVLYAKVHMKDGSNRLQELVDRVLERFQASGLIVKEWNSVKLHATV MNTLFRKDPNAEGRYNLYTAEGKYIFKERESFDGRNILKLFENFYFGSLKLNSIHISQRFTVDSFGNYAS CGQIDFS TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 41 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057031 |
Locus ID | 51008 |
UniProt ID | Q8N9N2 |
Refseq Size | 2150 |
Cytogenetics | 10q22.1 |
Refseq ORF | 1071 |
Synonyms | ASC1p50; CGI-18; RP11-150D20.4 |
Summary | This gene encodes a subunit of the activating signal cointegrator 1 (ASC-1) complex. The ASC-1 complex is a transcriptional coactivator that plays an important role in gene transactivation by multiple transcription factors including activating protein 1 (AP-1), nuclear factor kappa-B (NF-kB) and serum response factor (SRF). The encoded protein contains an N-terminal KH-type RNA-binding motif which is required for AP-1 transactivation by the ASC-1 complex. Mutations in this gene are associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414300 | ASCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434209 | ASCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414300 | Transient overexpression lysate of activating signal cointegrator 1 complex subunit 1 (ASCC1) |
CNY 3080.00 |
|
LY434209 | Transient overexpression lysate of activating signal cointegrator 1 complex subunit 1 (ASCC1), transcript variant 1 |
CNY 3080.00 |
|
PH301872 | ASCC1 MS Standard C13 and N15-labeled recombinant protein (NP_057031) |
CNY 19520.00 |