PKM2 (PKM) (NM_002654) Human Recombinant Protein
CAT#: TP301855
Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 1, 20 µg
View other "PKM2" proteins (12)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201855 protein sequence
Red=Cloning site Green=Tags(s) MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMN VARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVN LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRF DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002645 |
Locus ID | 5315 |
UniProt ID | P14618, V9HWB8 |
Refseq Size | 2516 |
Cytogenetics | 15q23 |
Refseq ORF | 1593 |
Synonyms | CTHBP; HEL-S-30; OIP3; p58; PK3; PKM2; TCB; THBP1 |
Summary | This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, Purine metabolism, Pyruvate metabolism, Type II diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405537 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC405538 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC419188 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405537 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 2 |
CNY 4,840.00 |
|
LY405538 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 3 |
CNY 4,840.00 |
|
LY419188 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 1 |
CNY 3,080.00 |
|
PH301855 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_002645) |
CNY 19,520.00 |
|
PH319382 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872270) |
CNY 19,520.00 |
|
PH322698 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872271) |
CNY 19,520.00 |
|
TP319382 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP322698 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP721212 | Purified recombinant protein of Human pyruvate kinase, muscle (PKM2), transcript variant 1 |
CNY 3,850.00 |