CRELD1 (NM_001031717) Human Recombinant Protein
CAT＃: TP301774
Recombinant protein of human cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 1, 20 µg
View other "CRELD1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201774 protein sequence
Red=Cloning site Green=Tags(s) MAPWPPKGLVPAVLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNKGLERTIRDNFGG GNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWWFHKQQEAPDLFQWLCSDSLK LCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLV CSACFGPCARCSGPEESNCLQCKKGWALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLG CMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPG AFPILTDLTPETTRRWKLGSHPHSTYVKMKMQRDEATFPGLYGKQVAKLGSQSRQSDRGTRLIHSQQASS QR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001026887 |
| Locus ID | 78987 |
| UniProt ID | Q96HD1 |
| Refseq Size | 2406 |
| Cytogenetics | 3p25.3 |
| Refseq ORF | 1266 |
| Synonyms | AVSD2; CIRRIN |
| Summary | This gene encodes a member of a subfamily of epidermal growth factor-related proteins. The encoded protein is characterized by a cysteine-rich with epidermal growth factor-like domain. This protein may function as a cell adhesion molecule. Mutations in this gene are the cause of atrioventricular septal defect. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414506 | CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421411 | CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422168 | CRELD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414506 | Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 2 |
CNY 4840.00 |
|
| LY421411 | Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 3 |
CNY 4840.00 |
|
| LY422168 | Transient overexpression lysate of cysteine-rich with EGF-like domains 1 (CRELD1), transcript variant 1 |
CNY 3080.00 |
|
| PH301774 | CRELD1 MS Standard C13 and N15-labeled recombinant protein (NP_001026887) |
CNY 19520.00 |
