Spermidine synthase (SRM) (NM_003132) Human Recombinant Protein
CAT#: TP301761
Recombinant protein of human spermidine synthase (SRM), 20 µg
View other "Spermidine synthase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201761 protein sequence
Red=Cloning site Green=Tags(s) MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQ CTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGM AIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQ WLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYN SDVHRAAFVLPEFARKALNDVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003123 |
| Locus ID | 6723 |
| UniProt ID | P19623 |
| Refseq Size | 1273 |
| Cytogenetics | 1p36.22 |
| Refseq ORF | 906 |
| Synonyms | PAPT; SPDSY; SPS1; SRML1 |
| Summary | The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine biosynthesis. This enzyme catalyzes the conversion of putrescine to spermidine using decarboxylated S-adenosylmethionine as the cofactor. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Arginine and proline metabolism, beta-Alanine metabolism, Cysteine and methionine metabolism, Glutathione metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
其它Spermidine synthase产品
