SF2 (SRSF1) (NM_006924) Human Recombinant Protein
CAT#: TP301636
Recombinant protein of human splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201636 protein sequence
Red=Cloning site Green=Tags(s) MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_008855 |
| Locus ID | 6426 |
| UniProt ID | Q07955 |
| Refseq Size | 5468 |
| Cytogenetics | 17q22 |
| Refseq ORF | 744 |
| Synonyms | ASF; SF2; SF2p33; SFRS1; SRp30a |
| Summary | This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 2014] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402060 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421492 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425877 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402060 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1 |
CNY 3080.00 |
|
| LY421492 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 |
CNY 3080.00 |
|
| LY425877 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 |
CNY 3080.00 |
|
| PH301636 | SFRS1 MS Standard C13 and N15-labeled recombinant protein (NP_008855) |
CNY 19520.00 |
|
| TP761870 | Purified recombinant protein of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
