GATA3 (NM_002051) Human Recombinant Protein
CAT＃: TP301618
Recombinant protein of human GATA binding protein 3 (GATA3), transcript variant 2, 20 µg
View other "GATA3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201618 protein sequence
Red=Cloning site Green=Tags(s) MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP TPMHPPSSLSFGPHHPSSMVTAMG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | GATA3 Activity Verified in a DNA-binding Assay: DNA binding activity of GATA3 as a function of protein concentration. Sensitivity to competitor oligonucleotide demonstrates specificity of protein-DNA binding. EMSA assay (PMID: 26216189) |
| Reference Data | |
| RefSeq | NP_002042 |
| Locus ID | 2625 |
| UniProt ID | P23771 |
| Refseq Size | 3067 |
| Cytogenetics | 10p14 |
| Refseq ORF | 1332 |
| Synonyms | HDR; HDRS |
| Summary | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009] |
| Protein Families | Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Gata3-controlled nucleosome eviction drives Myc enhancer activity in T-cell development and leukemia
,Belver, L;Yang, AY;Albero, R;Herranz, D;Brundu, FG;Quinn, SA;Perez-Duran, P;Alvarez, S;Gianni, F;Rashkovan, M;Gurung, D;Rocha, PP;Raviram, R;Reglero, C;Cortes, JR;Cooke, AJ;Wendorff, AA;Cordo, V;Meijerink, JP;Rabadan, R;Ferrando, AA;,
Cancer Discov
,PubMed ID 31519704
[GATA3]
|
|
Transactivation of human osteoprotegerin promoter by GATA-3
,Kao, SY;Stankovic, KM;,
Sci Rep
,PubMed ID 26216189
[GATA3]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400759 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424146 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400759 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 2 |
CNY 3080.00 |
|
| LY424146 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1 |
CNY 4840.00 |
|
| PH301618 | GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042) |
CNY 19520.00 |
|
| TP761574 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
|
| TP762348 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Pro189-Ser201(8 reapeat regions linked with GGGGS), with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
|
| TP762449 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Met1-Thr156, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
