Lamin B1 (LMNB1) (NM_005573) Human Recombinant Protein
CAT#: TP301604
Recombinant protein of human lamin B1 (LMNB1), 20 µg
View other "Lamin B1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 4 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201604 protein sequence
Red=Cloning site Green=Tags(s) MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEV RGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEA ALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKS MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIR DQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVL KAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEA AGVVVEEELFHQQGTPRASNRSCAIM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 66.2 kDa |
| Concentration | >0.1 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Proteolysis substrate (PMID: 27079252) |
| Reference Data | |
| RefSeq | NP_005564 |
| Locus ID | 4001 |
| UniProt ID | P20700 |
| Refseq Size | 3420 |
| Cytogenetics | 5q23.2 |
| Refseq ORF | 1758 |
| Synonyms | ADLD; LMN; LMN2; LMNB; MCPH26 |
| Summary | This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Citations (4)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Nuclear matrix metalloproteinase-2 in the cardiomyocyte and the ischemic-reperfused heart
,Baghirova, S;Hughes, BG;Poirier, M;Kondo, MY;Schulz, R;,
J. Mol. Cell. Cardiol.
,PubMed ID 27079252
[LMNB1]
|
|
Autophagy mediates degradation of nuclear lamina
,null,
Nature
,PubMed ID 26524528
[LMNB1]
|
|
Non-invasive intravital imaging of cellular differentiation with a bright red-excitable fluorescent protein
,null,
Nature methods
,PubMed ID 24633408
[LMNB1]
|
|
A bright monomeric green fluorescent protein derived from Branchiostoma lanceolatum
,null,
Nature methods
,PubMed ID 23524392
[LMNB1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417217 | LMNB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417217 | Transient overexpression lysate of lamin B1 (LMNB1) |
CNY 3080.00 |
|
| PH301604 | LMNB1 MS Standard C13 and N15-labeled recombinant protein (NP_005564) |
CNY 19520.00 |
|
| TP762496 | Purified recombinant protein of Human lamin B1 (LMNB1), transcript variant 1, 418Arg-582Ser, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2150.00 |
其它Lamin B1产品

