CENPA (NM_001042426) Human Recombinant Protein
CAT#: TP301602
Recombinant protein of human centromere protein A (CENPA), transcript variant 2, 20 µg
View other "CENPA" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201602 protein sequence
Red=Cloning site Green=Tags(s) MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001035891 |
| Locus ID | 1058 |
| UniProt ID | P49450 |
| Refseq Size | 1352 |
| Cytogenetics | 2p23.3 |
| Refseq ORF | 342 |
| Synonyms | CenH3; CENP-A |
| Summary | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Protein-Based Immunome Wide Association Studies (PIWAS) for the Discovery of Significant Disease-Associated Antigens
,null,
Frontiers in Immunology
,PubMed ID 33986742
[CENPA]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400687 | CENPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420896 | CENPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400687 | Transient overexpression lysate of centromere protein A (CENPA), transcript variant 1 |
CNY 3080.00 |
|
| LY420896 | Transient overexpression lysate of centromere protein A (CENPA), transcript variant 2 |
CNY 3080.00 |
|
| PH301602 | CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001035891) |
CNY 19520.00 |
|
| PH324761 | CENPA MS Standard C13 and N15-labeled recombinant protein (NP_001800) |
CNY 19520.00 |
|
| TP324761 | Recombinant protein of human centromere protein A (CENPA), transcript variant 1, 20 µg |
CNY 2900.00 |
