CFDP1 (NM_006324) Human Recombinant Protein
CAT#: TP301581
Recombinant protein of human craniofacial development protein 1 (CFDP1), 20 µg
View other "CFDP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201581 protein sequence
Red=Cloning site Green=Tags(s) MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSL EEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETE ETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALP SLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDR VDHRQFEIERDLRLSKMKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006315 |
| Locus ID | 10428 |
| UniProt ID | Q9UEE9 |
| Refseq Size | 1281 |
| Cytogenetics | 16q23.1 |
| Refseq ORF | 897 |
| Synonyms | BCNT; BUCENTAUR; CENP-29; CP27; p97; SWC5; Yeti |
| Summary | May play a role during embryogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416717 | CFDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416717 | Transient overexpression lysate of craniofacial development protein 1 (CFDP1) |
CNY 3080.00 |
|
| PH301581 | CFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_006315) |
CNY 19520.00 |
