CSRP2 (NM_001321) Human Recombinant Protein
CAT#: TP301565
Recombinant protein of human cysteine and glycine-rich protein 2 (CSRP2), 20 µg
View other "CSRP2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201565 protein sequence
Red=Cloning site Green=Tags(s) MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG YGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWH KNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001312 |
Locus ID | 1466 |
UniProt ID | Q16527 |
Refseq Size | 940 |
Cytogenetics | 12q21.2 |
Refseq ORF | 579 |
Synonyms | CRP2; LMO5; SmLIM |
Summary | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Cross-reactivity of a pathogenic autoantibody to a tumor antigen in GABAA receptor encephalitis
,Brändle, SM;Cerina, M;Weber, S;Held, K;Menke, AF;Alcalá, C;Gebert, D;Herrmann, AM;Pellkofer, H;Gerdes, LA;Bittner, S;Leypoldt, F;Teegen, B;Komorowski, L;Kümpfel, T;Hohlfeld, R;Meuth, SG;Casanova, B;Melzer, N;Beltrán, E;Dornmair, K;,
Proceedings of the National Academy of Sciences of the United States of America
,PubMed ID 33619082
[CSRP2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400526 | CSRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400526 | Transient overexpression lysate of cysteine and glycine-rich protein 2 (CSRP2) |
CNY 3080.00 |
|
PH301565 | CSRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001312) |
CNY 19520.00 |