SPOP (NM_001007229) Human Recombinant Protein
CAT＃: TP301551
Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6, 20 µg
View other "SPOP" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201551 protein sequence
Red=Cloning site Green=Tags(s) MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA EAYRSLASAQCPFLGPPRKRLKQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | MS digestion standard (PMID: 28810879) |
| Reference Data | |
| RefSeq | NP_001007230 |
| Locus ID | 8405 |
| UniProt ID | O43791 |
| Refseq Size | 2982 |
| Cytogenetics | 17q21.33 |
| Refseq ORF | 1122 |
| Synonyms | BTBD32; NEDMACE; NEDMIDF; NSDVS1; NSDVS2; TEF2 |
| Summary | This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Quantification of mutant SPOP proteins in prostate cancer using mass spectrometry-based targeted proteomics
,Wang, H;Barbieri, CE;He, J;Gao, Y;Shi, T;Wu, C;Schepmoes, AA;Fillmore, TL;Chae, SS;Huang, D;Mosquera, JM;Qian, WJ;Smith, RD;Srivastava, S;Kagan, J;Camp, DG;Rodland, KD;Rubin, MA;Liu, T;,
J Transl Med
,PubMed ID 28810879
[SPOP]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401186 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423451 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423453 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423454 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425209 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401186 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 2 |
CNY 3080.00 |
|
| LY423451 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 1 |
CNY 3080.00 |
|
| LY423453 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 |
CNY 3080.00 |
|
| LY423454 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 6 |
CNY 3080.00 |
|
| LY425209 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 |
CNY 3080.00 |
|
| PH301551 | SPOP MS Standard C13 and N15-labeled recombinant protein (NP_001007230) |
CNY 19520.00 |
