Glutathione S Transferase kappa 1 (GSTK1) (NM_015917) Human Recombinant Protein
CAT#: TP301467
Recombinant protein of human glutathione S-transferase kappa 1 (GSTK1), transcript variant 1, 20 µg
View other "Glutathione S Transferase kappa 1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201467 protein sequence
Red=Cloning site Green=Tags(s) MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDL KLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILA AAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLL GEKWMGPIPPAVNARL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057001 |
| Locus ID | 373156 |
| UniProt ID | Q9Y2Q3 |
| Refseq Size | 1058 |
| Cytogenetics | 7q34 |
| Refseq ORF | 678 |
| Synonyms | GST; GST13; GST 13-13; GST13-13; GSTK1-1; hGSTK1 |
| Summary | This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009] |
| Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414320 | GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428317 | GSTK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414320 | Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 1 |
CNY 3080.00 |
|
| LY428317 | Transient overexpression lysate of glutathione S-transferase kappa 1 (GSTK1), transcript variant 4 |
CNY 3080.00 |
|
| PH301467 | GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_057001) |
CNY 19520.00 |
|
| PH326807 | GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_001137153) |
CNY 14250.00 |
|
| TP326807 | Purified recombinant protein of Homo sapiens glutathione S-transferase kappa 1 (GSTK1), transcript variant 4, 20 µg |
CNY 2900.00 |
其它Glutathione S Transferase kappa 1产品
