RAB10 (NM_016131) Human Recombinant Protein
CAT#: TP301464
Recombinant protein of human RAB10, member RAS oncogene family (RAB10), 20 µg
View other "RAB10" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201464 protein sequence
Red=Cloning site Green=Tags(s) MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQER FHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQI AREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057215 |
| Locus ID | 10890 |
| UniProt ID | P61026 |
| Refseq Size | 3785 |
| Cytogenetics | 2p23.3 |
| Refseq ORF | 600 |
| Summary | RAB10 belongs to the RAS (see HRAS; MIM 190020) superfamily of small GTPases. RAB proteins localize to exocytic and endocytic compartments and regulate intracellular vesicle trafficking (Bao et al., 1998 [PubMed 9918381]).[supplied by OMIM, Mar 2009] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Vitamin B12 modulates Parkinson's disease LRRK2 kinase activity through allosteric regulation and confers neuroprotection
,Schaffner, A;Li, X;Gomez-Llorente, Y;Leandrou, E;,
Cell research
,PubMed ID 30858560
[RAB10]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414160 | RAB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414160 | Transient overexpression lysate of RAB10, member RAS oncogene family (RAB10) |
CNY 3080.00 |
|
| PH301464 | RAB10 MS Standard C13 and N15-labeled recombinant protein (NP_057215) |
CNY 19520.00 |
