BRP44L (MPC1) (NM_016098) Human Recombinant Protein
CAT#: TP301461
Recombinant protein of human brain protein 44-like (BRP44L), 20 µg
View other "BRP44L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201461 protein sequence
Red=Cloning site Green=Tags(s) MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA YKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057182 |
| Locus ID | 51660 |
| UniProt ID | Q9Y5U8 |
| Refseq Size | 977 |
| Cytogenetics | 6q27 |
| Refseq ORF | 327 |
| Synonyms | BRP44L; CGI-129; MPYCD; SLC54A1 |
| Summary | The protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene. [provided by RefSeq, Aug 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414188 | MPC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414188 | Transient overexpression lysate of brain protein 44-like (BRP44L) |
CNY 3080.00 |
|
| PH301461 | BRP44L MS Standard C13 and N15-labeled recombinant protein (NP_057182) |
CNY 19520.00 |
