SDHAF2 (NM_017841) Human Recombinant Protein
CAT#: TP301437
Recombinant protein of human chromosome 11 open reading frame 79 (C11orf79), 20 µg
View other "SDHAF2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201437 protein sequence
Red=Cloning site Green=Tags(s) MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARL LYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALL RDFAKNKNKEQRLRAPDLEYLFEKPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060311 |
Locus ID | 54949 |
UniProt ID | Q9NX18 |
Refseq Size | 1227 |
Cytogenetics | 11q12.2 |
Refseq ORF | 498 |
Synonyms | C11orf79; PGL2; SDH5 |
Summary | This gene encodes a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. Mutations in this gene are associated with paraganglioma.[provided by RefSeq, Jul 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402625 | SDHAF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402625 | Transient overexpression lysate of succinate dehydrogenase complex assembly factor 2 (SDHAF2) |
CNY 3080.00 |
|
PH301437 | SDHAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060311) |
CNY 19520.00 |