OSBPL2 (NM_144498) Human Recombinant Protein
CAT#: TP301344
Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 2, 20 µg
View other "OSBPL2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201344 protein sequence
Red=Cloning site Green=Tags(s) MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSLPAPMFS RSDFSVWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSA VASQWERTGKPFNPLLGETYELIREDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKS VEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKEL HKVEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVA QETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLAS QEKERLEEKQREARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_653081 |
Locus ID | 9885 |
UniProt ID | Q9H1P3 |
Refseq Size | 4027 |
Cytogenetics | 20q13.33 |
Refseq ORF | 1440 |
Synonyms | DFNA67; DNFA67; ORP-2; ORP2 |
Summary | This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although the encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408266 | OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414990 | OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY408266 | Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 2 |
CNY 3080.00 |
|
LY414990 | Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 1 |
CNY 4840.00 |
|
PH301344 | OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_653081) |
CNY 19520.00 |
|
PH315660 | OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_055650) |
CNY 19520.00 |
|
TP315660 | Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 1, 20 µg |
CNY 2900.00 |