PP2A-alpha (PPP2CA) (NM_002715) Human Recombinant Protein
CAT#: TP301334
Recombinant protein of human protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA), 20 µg
View other "PP2A-alpha" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201334 protein sequence
Red=Cloning site Green=Tags(s) MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002706 |
| Locus ID | 5515 |
| UniProt ID | P67775 |
| Refseq Size | 2643 |
| Cytogenetics | 5q31.1 |
| Refseq ORF | 927 |
| Synonyms | NEDLBA; PP2Ac; PP2CA; PP2Calpha; RP-C |
| Summary | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase, Transcription Factors |
| Protein Pathways | Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Covalent Ligand Discovery Against Druggable Hotspots Targeted by Anti-Cancer Natural Products
,null,
Cell chemical biology
,PubMed ID 28919038
[PPP2CA]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419151 | PPP2CA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419151 | Transient overexpression lysate of protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA) |
CNY 3080.00 |
|
| PH301334 | PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706) |
CNY 19520.00 |
|
| TP750222 | Purified recombinant protein of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform , full length(266Ser, 269Ser), with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
其它PP2A-alpha产品
