TRIM32 (NM_012210) Human Recombinant Protein
CAT＃: TP301289
Recombinant protein of human tripartite motif-containing 32 (TRIM32), transcript variant 1, 20 µg
View other "TRIM32" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201289 protein sequence
Red=Cloning site Green=Tags(s) MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL LVLDCWDHCIKIYSYHLRRYSTP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 71.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_036342 |
| Locus ID | 22954 |
| UniProt ID | Q13049 |
| Refseq Size | 3734 |
| Cytogenetics | 9q33.1 |
| Refseq ORF | 1959 |
| Synonyms | BBS11; HT2A; LGMD2H; LGMDR8; TATIP |
| Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Ubiquitin mediated proteolysis |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402167 | TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420491 | TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426077 | TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402167 | Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 1 |
CNY 3080.00 |
|
| LY420491 | Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 2 |
CNY 4840.00 |
|
| PH301289 | TRIM32 MS Standard C13 and N15-labeled recombinant protein (NP_036342) |
CNY 19520.00 |
|
| PH323796 | TRIM32 MS Standard C13 and N15-labeled recombinant protein (NP_001093149) |
CNY 14250.00 |
|
| TP323796 | Purified recombinant protein of Homo sapiens tripartite motif-containing 32 (TRIM32), transcript variant 2, 20 µg |
CNY 2900.00 |
