SSH3BP1 (ABI1) (NM_001012752) Human Recombinant Protein
CAT#: TP301264
Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 4, 20 µg
View other "SSH3BP1" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201264 protein sequence
Red=Cloning site Green=Tags(s) MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALAN NVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKP IDYTVLDDVGHGVKHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMT SPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYG TMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFV ARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVV AIYDYTKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESIMHYTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001012770 |
| Locus ID | 10006 |
| UniProt ID | Q8IZP0 |
| Refseq Size | 3629 |
| Cytogenetics | 10p12.1 |
| Refseq ORF | 1428 |
| Synonyms | ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1 |
| Summary | This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Sep 2011] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
An autism-linked missense mutation in SHANK3 reveals the modularity of Shank3 function
,Wang, L;Pang, K;Han, K;Adamski, CJ;Wang, W;He, L;Lai, JK;Bondar, VV;Duman, JG;Richman, R;Tolias, KF;Barth, P;Palzkill, T;Liu, Z;Holder, JL;Zoghbi, HY;,
Mol. Psychiatry
,PubMed ID 30610205
[ABI1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401677 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422826 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422828 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432894 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433150 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433176 | ABI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401677 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 1 |
CNY 4840.00 |
|
| LY422826 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 2 |
CNY 4840.00 |
|
| LY422828 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 4 |
CNY 3080.00 |
|
| LY432894 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 12 |
CNY 3080.00 |
|
| LY433150 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 6 |
CNY 3080.00 |
|
| LY433176 | Transient overexpression lysate of abl-interactor 1 (ABI1), transcript variant 5 |
CNY 3080.00 |
|
| PH301264 | ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_001012770) |
CNY 19520.00 |
|
| PH317707 | ABI1 MS Standard C13 and N15-labeled recombinant protein (NP_005461) |
CNY 19520.00 |
|
| TP317707 | Recombinant protein of human abl-interactor 1 (ABI1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP329894 | Purified recombinant protein of Homo sapiens abl-interactor 1 (ABI1), transcript variant 12, 20 µg |
CNY 2900.00 |
其它SSH3BP1产品
