Neurogranin (NRGN) (NM_006176) Human Recombinant Protein
CAT#: TP301209
Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, 20 µg
View other "Neurogranin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 3 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201209 protein sequence
Red=Cloning site Green=Tags(s) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG AGGGPSGD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA standard (PMID: 29250027) |
Reference Data | |
RefSeq | NP_006167 |
Locus ID | 4900 |
UniProt ID | Q92686 |
Refseq Size | 1235 |
Cytogenetics | 11q24.2 |
Refseq ORF | 234 |
Synonyms | hng; RC3 |
Summary | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
The intact postsynaptic protein neurogranin is reduced in brain tissue from patients with familial and sporadic Alzheimer’s disease
,null,
Acta Neuropathologica
,PubMed ID 30244311
[NRGN]
|
Alzheimer-associated cerebrospinal fluid fragments of neurogranin are generated by Calpain-1 and prolyl endopeptidase
,null,
Molecular Neurodegeneration
,PubMed ID 30157938
[NRGN]
|
Derivation of a Three Biomarker Panel to Improve Diagnosis in Patients with Mild Traumatic Brain Injury
,Peacock, WF;Van Meter, TE;Mirshahi, N;Ferber, K;Gerwien, R;Rao, V;Sair, HI;Diaz-Arrastia, R;Korley, FK;,
Front Neurol
,PubMed ID 29250027
[NRGN]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416815 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426667 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416815 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
CNY 3080.00 |
|
LY426667 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 |
CNY 3080.00 |
|
PH301209 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167) |
CNY 19520.00 |
|
PH324996 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_001119653) |
CNY 19520.00 |
|
TP324996 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Neurogranin产品