DHRS3 (NM_004753) Human Recombinant Protein
CAT#: TP301180
Recombinant protein of human dehydrogenase/reductase (SDR family) member 3 (DHRS3), 20 µg
View other "DHRS3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201180 protein sequence
Red=Cloning site Green=Tags(s) MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWG RTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCP GVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQA ALEEIHKFSGTYTCMNTFKGRT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004744 |
Locus ID | 9249 |
UniProt ID | O75911 |
Refseq Size | 1741 |
Cytogenetics | 1p36.21 |
Refseq ORF | 906 |
Synonyms | DD83.1; RDH17; retSDR1; Rsdr1; SDR1; SDR16C1 |
Summary | Short-chain dehydrogenases/reductases (SDRs), such as DHRS3, catalyze the oxidation/reduction of a wide range of substrates, including retinoids and steroids (Haeseleer and Palczewski, 2000 [PubMed 10800688]).[supplied by OMIM, Jun 2009] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401496 | DHRS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401496 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 3 (DHRS3) |
CNY 3080.00 |
|
PH301180 | DHRS3 MS Standard C13 and N15-labeled recombinant protein (NP_004744) |
CNY 19520.00 |