VTI1B (NM_006370) Human Recombinant Protein
CAT#: TP301172
Recombinant protein of human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B), 20 µg
View other "VTI1B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201172 protein sequence
Red=Cloning site Green=Tags(s) MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS IIILLELAILGGLVYYKFFRSH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006361 |
Locus ID | 10490 |
UniProt ID | Q9UEU0 |
Refseq Size | 1357 |
Cytogenetics | 14q24.1 |
Refseq ORF | 696 |
Synonyms | v-SNARE; VTI1; VTI1-LIKE; vti1-rp1; VTI1L; VTI2 |
Summary | V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416689 | VTI1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416689 | Transient overexpression lysate of vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B) |
CNY 3080.00 |
|
PH301172 | VTI1B MS Standard C13 and N15-labeled recombinant protein (NP_006361) |
CNY 19520.00 |