IDH2 (NM_002168) Human Recombinant Protein
CAT#: TP301152
Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, 20 µg
View other "IDH2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201152 protein sequence
Red=Cloning site Green=Tags(s) MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002159 |
| Locus ID | 3418 |
| UniProt ID | P48735 |
| Refseq Size | 1818 |
| Cytogenetics | 15q26.1 |
| Refseq ORF | 1356 |
| Synonyms | D2HGA2; ICD-M; IDH; IDHM; IDP; IDPM; mNADP-IDH |
| Summary | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
| Protein Pathways | Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400787 | IDH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400787 | Transient overexpression lysate of isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH301152 | IDH2 MS Standard C13 and N15-labeled recombinant protein (NP_002159) |
CNY 19520.00 |
|
| TP700057 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172K), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6650.00 |
|
| TP700058 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172M), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6650.00 |
|
| TP700059 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172G), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CNY 6650.00 |
|
| TP710214 | Purified recombinant protein of mutant(R172G) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg |
CNY 4020.00 |
|
| TP710215 | Purified recombinant protein of mutant(R172M) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg |
CNY 4020.00 |
|
| TP710216 | Purified recombinant protein of mutant(R172K) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg |
CNY 4020.00 |
|
| TP710217 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, full length, with C-terminal HIS tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
| TP710228 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172G) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg |
CNY 4020.00 |
|
| TP710229 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172M) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg |
CNY 4020.00 |
|
| TP710230 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172K) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg |
CNY 4020.00 |


