TRIAP1 (NM_016399) Human Recombinant Protein
CAT#: TP301032
Recombinant protein of human TP53 regulated inhibitor of apoptosis 1 (TRIAP1), 20 µg
View other "TRIAP1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC201032 protein sequence 
Red=Cloning site Green=Tags(s) MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE KPENSS myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 8.6 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_057483 | 
| Locus ID | 51499 | 
| UniProt ID | O43715 | 
| Refseq Size | 1196 | 
| Cytogenetics | 12q24.31 | 
| Refseq ORF | 228 | 
| Synonyms | HSPC132; MDM35; P53CSV; WF-1 | 
| Summary | Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane (PubMed:23931759). Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo) (PubMed:26071602). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis (PubMed:15735003).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC413997 | TRIAP1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY413997 | Transient overexpression lysate of TP53 regulated inhibitor of apoptosis 1 (TRIAP1) | 
                                                     CNY 3080.00  | 
                                            |
| PH301032 | TRIAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057483) | 
                                                     CNY 19520.00  | 
                                            
