CD71 (TFRC) (NM_003234) Human Recombinant Protein
CAT＃: TP300980
Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg
View other "CD71" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200980 representing NM_003234
Red=Cloning site Green=Tags(s) MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 84.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003225 |
| Locus ID | 7037 |
| UniProt ID | P02786 |
| Refseq Size | 5010 |
| Cytogenetics | 3q29 |
| Refseq ORF | 2280 |
| Synonyms | CD71; IMD46; p90; T9; TFR; TFR1; TR; TRFR |
| Summary | This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protease, Secreted Protein, Transmembrane |
| Protein Pathways | Endocytosis, Hematopoietic cell lineage |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Using Quantitative Seroproteomics to Identify Antibody Biomarkers in Pancreatic Cancer
,null,
Cancer immunology research
,PubMed ID 26842750
[TFRC]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418818 | TFRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426898 | TFRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418818 | Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) |
CNY 3080.00 |
|
| LY426898 | Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) |
CNY 4840.00 |
|
| PH300980 | TFRC MS Standard C13 and N15-labeled recombinant protein (NP_003225) |
CNY 19520.00 |
|
| PH326147 | TFRC MS Standard C13 and N15-labeled recombinant protein (NP_001121620) |
CNY 19520.00 |
|
| TP326147 | Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg |
CNY 2900.00 |
TFRC mouse monoclonal antibody,clone OTI6H9
