ASMTL (NM_004192) Human Recombinant Protein
CAT#: TP300930
Recombinant protein of human acetylserotonin O-methyltransferase-like (ASMTL), 20 µg
View other "ASMTL" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200930 protein sequence
Red=Cloning site Green=Tags(s) MVLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKASFATPYGYAMETAKQKALEVA NRLYQKDLRAPDVVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHSVFTGVAIVHCSSKDHQLDTR VSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCKQLVK LYYPPRPEDLRRSVKHDSIPAADTFEDLSDVEGGGSEPTQRDAGSRDEKAEAGEAGQATAEAECHRTRET LPPFPTRLLELIEGFMLSKGLLTACKLKVFDLLKDEAPQKAADIASKVDASACGMERLLDICAAMGLLEK TEQGYSNTETANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQDAYYQ SPETRLRFMRAMHGMTKLTACQVATAFNLSRFSSACDVGGCTGALARELAREYPRMQVTVFDLPDIIELA AHFQPPGPQAVQIHFAAGDFFRDPLPSAELYVLCRILHDWPDDKVHKLLSKVAESCKPGAGLLLVETLLD EEKRVAQRALMQSLNMLVQTEGKERSLGEYQCLLELHGFHQVQVVHLGGVLDAILATKVAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 68.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004183 |
| Locus ID | 8623 |
| UniProt ID | O95671 |
| Refseq Size | 2149 |
| Cytogenetics | X;Y |
| Refseq ORF | 1863 |
| Synonyms | ASMTLX; ASMTLY; ASTML |
| Summary | The protein encoded by this gene has an N-terminus that is similar to the multicopy associated filamentation (maf) protein of Bacillus subtilis and to orfE of Escherichia coli, while the C-terminus is similar to N-acetylserotonin O-methyltransferase. This gene is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418150 | ASMTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433335 | ASMTL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418150 | Transient overexpression lysate of acetylserotonin O-methyltransferase-like (ASMTL) |
CNY 3080.00 |
|
| LY433335 | Transient overexpression lysate of acetylserotonin O-methyltransferase-like (ASMTL), transcript variant 3 |
CNY 3080.00 |
|
| PH300930 | ASMTL MS Standard C13 and N15-labeled recombinant protein (NP_004183) |
CNY 19520.00 |
