AARSD1 (PTGES3L-AARSD1) (NM_025267) Human Recombinant Protein
CAT#: TP300884
Recombinant protein of human alanyl-tRNA synthetase domain containing 1 (AARSD1), transcript variant 2, 20 µg
View other "AARSD1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200884 protein sequence
Red=Cloning site Green=Tags(s) MEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWP RLTKEDIKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDFTTTVVSCCPAELQ TEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDDRGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRV DWERRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLP VNVRELSLDDPEVEQVSGRGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTN LIFLSGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIAHSLRNS PDWGGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKG AGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_079543 |
| Locus ID | 100885850 |
| UniProt ID | Q9BTE6 |
| Refseq Size | 1800 |
| Cytogenetics | 17q21.31 |
| Refseq ORF | 1575 |
| Summary | This locus represents naturally occurring readthrough transcription between the neighboring PTGES3L (prostaglandin E synthase 3 (cytosolic)-like) and AARSD1(alanyl-tRNA synthetase domain containing 1) genes on chromosome 17. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product. [provided by RefSeq, May 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410824 | PTGES3L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427789 | PTGES3L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410824 | Transient overexpression lysate of alanyl-tRNA synthetase domain containing 1 (AARSD1), transcript variant 2 |
CNY 3080.00 |
|
| LY427789 | Transient overexpression lysate of alanyl-tRNA synthetase domain containing 1 (AARSD1), transcript variant 1 |
CNY 3080.00 |
|
| PH300884 | AARSD1 MS Standard C13 and N15-labeled recombinant protein (NP_079543) |
CNY 19520.00 |
