OBFC2B (NABP2) (NM_024068) Human Recombinant Protein
CAT#: TP300876
Recombinant protein of human oligonucleotide/oligosaccharide-binding fold containing 2B (OBFC2B), 20 µg
View other "OBFC2B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200876 protein sequence
Red=Cloning site Green=Tags(s) MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRL TKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGP SAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVSNGKETRRSSK R myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076973 |
Locus ID | 79035 |
UniProt ID | Q9BQ15 |
Refseq Size | 1404 |
Cytogenetics | 12q13.3 |
Refseq ORF | 633 |
Synonyms | hSSB1; OBFC2B; SOSS-B1; SSB1 |
Summary | Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2B, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplied by OMIM, Jun 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411384 | NABP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411384 | Transient overexpression lysate of oligonucleotide/oligosaccharide-binding fold containing 2B (OBFC2B) |
CNY 3080.00 |
|
PH300876 | OBFC2B MS Standard C13 and N15-labeled recombinant protein (NP_076973) |
CNY 19520.00 |