robld3 (LAMTOR2) (NM_014017) Human Recombinant Protein

CAT#: TP300862L

Recombinant protein of human roadblock domain containing 3 (ROBLD3), transcript variant 1, 1 mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 36000.00


货期*
4周

规格
    • 1 mg

Product images

推荐一起购买 (2)
Rabbit Polyclonal Anti-LAMTOR2 Antibody
    • 100 ug

CNY 5808.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200862 protein sequence
Red=Cloning site Green=Tags(s)

MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLK
FILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_054736
Locus ID 28956
UniProt ID Q9Y2Q5
Refseq Size 699
Cytogenetics 1q22
Refseq ORF 375
Synonyms ENDAP; HSPC003; MAPBPIP; MAPKSP1AP; p14; Ragulator2; ROBLD3
Summary The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...