MANBAL (NM_001003897) Human Recombinant Protein
CAT#: TP300796
Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2, 20 µg
View other "MANBAL" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200796 protein sequence
Red=Cloning site Green=Tags(s) MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV PSVNKRPKKETKKKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001003897 |
Locus ID | 63905 |
UniProt ID | Q9NQG1 |
Refseq Size | 1268 |
Cytogenetics | 20q11.23 |
Refseq ORF | 255 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411800 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424033 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411800 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1 |
CNY 3080.00 |
|
LY424033 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 |
CNY 3080.00 |
|
PH300796 | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897) |
CNY 19520.00 |
|
PH305099 | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) |
CNY 19520.00 |
|
TP305099 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1, 20 µg |
CNY 2900.00 |