TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein
CAT#: TP300773
Recombinant protein of human TGFB-induced factor homeobox 2 (TGIF2), 20 µg
View other "TGF beta induced factor 2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200773 protein sequence
Red=Cloning site Green=Tags(s) MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA EMELQKQQDPSLPLLHTPIPLVSENPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_068581 |
| Locus ID | 60436 |
| UniProt ID | Q9GZN2 |
| Refseq Size | 3415 |
| Cytogenetics | 20q11.23 |
| Refseq ORF | 711 |
| Summary | The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor, which appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and over-expressed in some ovarian cancers. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. Read-through transcription also exists between this gene and the neighboring downstream C20orf24 (chromosome 20 open reading frame 24) gene. [provided by RefSeq, Dec 2010] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411916 | TGIF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411916 | Transient overexpression lysate of TGFB-induced factor homeobox 2 (TGIF2) |
CNY 3080.00 |
|
| PH300773 | TGIF2 MS Standard C13 and N15-labeled recombinant protein (NP_068581) |
CNY 19520.00 |
其它TGF beta induced factor 2产品
