HIC5 (TGFB1I1) (NM_015927) Human Recombinant Protein
CAT#: TP300761
Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2, 20 µg
View other "HIC5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200761 protein sequence
Red=Cloning site Green=Tags(s) MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP LTKGSFQERAGKPYCQPCFLKLFG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057011 |
| Locus ID | 7041 |
| UniProt ID | O43294 |
| Refseq Size | 1812 |
| Cytogenetics | 16p11.2 |
| Refseq ORF | 1332 |
| Synonyms | ARA55; HIC-5; HIC5; TSC-5 |
| Summary | This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402475 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431927 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402475 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2 |
CNY 3080.00 |
|
| LY431927 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3 |
CNY 3080.00 |
|
| PH300761 | TGFB1I1 MS Standard C13 and N15-labeled recombinant protein (NP_057011) |
CNY 19520.00 |
|
| TP328899 | Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3, 20 µg |
CNY 2900.00 |
