KCTD14 (NM_023930) Human Recombinant Protein
CAT#: TP300745
Recombinant protein of human potassium channel tetramerisation domain containing 14 (KCTD14), 20 µg
View other "KCTD14" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200745 protein sequence
Red=Cloning site Green=Tags(s) MSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDRPSTYFRPILDYLRTGQVPT QHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLV CLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDNSDLMHCLEMDIKAQGYKVFSKFYLTYPTKR NEFHFNIYSFTFTWW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_076419 |
| Locus ID | 65987 |
| UniProt ID | Q9BQ13 |
| Refseq Size | 1688 |
| Cytogenetics | 11q14.1 |
| Refseq ORF | 675 |
| Protein Families | Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411435 | KCTD14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411435 | Transient overexpression lysate of potassium channel tetramerisation domain containing 14 (KCTD14) |
CNY 3080.00 |
|
| PH300745 | KCTD14 MS Standard C13 and N15-labeled recombinant protein (NP_076419) |
CNY 19520.00 |
