ALDH1B1 (NM_000692) Human Recombinant Protein
CAT#: TP300684
Recombinant protein of human aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein, 20 µg
View other "ALDH1B1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200684 protein sequence
Red=Cloning site Green=Tags(s) MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAE GDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLD EVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKV AEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLK RVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGN GRELGEDGLKAYTEVKTVTIKVPQKNS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000683 |
| Locus ID | 219 |
| UniProt ID | P30837 |
| Refseq Size | 3088 |
| Cytogenetics | 9p13.1 |
| Refseq ORF | 1551 |
| Synonyms | ALDH5; ALDHX |
| Summary | This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arginine and proline metabolism, Ascorbate and aldarate metabolism, beta-Alanine metabolism, Butanoate metabolism, Fatty acid metabolism, Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Histidine metabolism, Limonene and pinene degradation, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
A noncanonical function of EIF4E limits ALDH1B1 activity and increases susceptibility to ferroptosis
,null,
Nature Communications
,PubMed ID 36274088
[ALDH1B1]
|
|
Human ALDH1B1 polymorphisms may affect the metabolism of acetaldehyde and all- trans retinaldehyde – in vitro studies and computational modeling
,null,
Pharmaceutical research
,PubMed ID 25413692
[ALDH1B1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424568 | ALDH1B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424568 | Transient overexpression lysate of aldehyde dehydrogenase 1 family, member B1 (ALDH1B1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| PH300684 | ALDH1B1 MS Standard C13 and N15-labeled recombinant protein (NP_000683) |
CNY 19520.00 |
其它ALDH1B1产品
