S100A11 (NM_005620) Human Recombinant Protein
CAT#: TP300656
Recombinant protein of human S100 calcium binding protein A11 (S100A11), 20 µg
View other "S100A11" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200656 protein sequence 
Red=Cloning site Green=Tags(s) MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN SDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 11.6 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_005611 | 
| Locus ID | 6282 | 
| UniProt ID | P31949 | 
| Refseq Size | 595 | 
| Cytogenetics | 1q21.3 | 
| Refseq ORF | 315 | 
| Synonyms | HEL-S-43; MLN70; S100C | 
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq, Jul 2008] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC417184 | S100A11 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY417184 | Transient overexpression lysate of S100 calcium binding protein A11 (S100A11) | 
                                                     CNY 3080.00  | 
                                            |
| PH300656 | S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611) | 
                                                     CNY 19520.00  | 
                                            
其它S100A11产品
