RNase H1 (RNASEH1) (NM_002936) Human Recombinant Protein
CAT#: TP300595
Recombinant protein of human ribonuclease H1 (RNASEH1), 20 µg
View other "RNase H1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200595 protein sequence
Red=Cloning site Green=Tags(s) MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAF VRKSASPEVSEGHENQHGQESEAKASKRLREPLDGDGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFV VVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTD SMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREG AKQSED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002927 |
| Locus ID | 246243 |
| UniProt ID | O60930 |
| Refseq Size | 1865 |
| Cytogenetics | 2p25.3 |
| Refseq ORF | 858 |
| Synonyms | H1RNA; PEOB2; RNH1 |
| Summary | This gene encodes an endonuclease that specifically degrades the RNA of RNA-DNA hybrids and plays a key role in DNA replication and repair. Alternate in-frame start codon initiation results in the production of alternate isoforms that are directed to the mitochondria or to the nucleus. The production of the mitochondrial isoform is modulated by an upstream open reading frame (uORF). Mutations in this gene have been found in individuals with progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 2. Alternative splicing results in additional coding and non-coding transcript variants. Pseudogenes of this gene have been defined on chromosomes 2 and 17. [provided by RefSeq, Jul 2017] |
| Protein Pathways | DNA replication |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401027 | RNASEH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401027 | Transient overexpression lysate of ribonuclease H1 (RNASEH1) |
CNY 3080.00 |
|
| PH300595 | RNASEH1 MS Standard C13 and N15-labeled recombinant protein (NP_002927) |
CNY 19520.00 |
其它RNase H1产品
